PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G18460.1
Common NameLOC102714939
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 773aa    MW: 85302.2 Da    PI: 6.7549
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G18460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.81.6e-1760116157
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                   +rk + +t++q ++L+ +F+++ +p+++++eeLA++l+++ ++V++WFqN+++++k+
  OB08G18460.1  60 KRKYQVLTAQQRDRLNCAFQSCLHPDQNAIEELANELNMSPDRVRYWFQNHKTQMKR 116
                   79999**************************************************97 PP

2START101.31.7e-3226948716204
                   HC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT......EEEE CS
         START  16 aeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg......galq 92 
                   ++e++W         es+n++++l k  +  +     ++++a r++++v + +a+lv+ l d++  W e ++    +a t+  is+g      g lq
  OB08G18460.1 269 EDEALWLPNMdilavESLNYQKYLAKSMTI-GlkpvnFKVDATRDTAIVKGSCADLVKGLSDVN-WWRELFPgivaSANTTRIISTGhsnscdGLLQ 363
                   566777666666677999999999998553.3588889**************************.****9999999********************* PP

                   EEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE..........-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX CS
         START  93 lmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvR..........aellpSgiliepksnghskvtwvehvdlkgrlp 177
                   lm aelq++sp  p  d++f+R++ q g g w++vdvS++s   +++ s+++v           ++ lpSg++i++++ng+skv w+ h+ +++r++
  OB08G18460.1 364 LMHAELQVMSPEIPvGDVTFLRQCVQNGTGLWYVVDVSINSVLGKSKsSQHSVQstrtterhmeVRFLPSGCIIQEMGNGYSKVNWMVHAVYDERVI 460
                   *****************************************999998855555411122222226779***************************** PP

                   HHHHHHHHHHHHHHHHHHHHHHTXXXX CS
         START 178 hwllrslvksglaegaktwvatlqrqc 204
                   ++l  +l++sg a ga +wva lqr+ 
  OB08G18460.1 461 QELHWPLLRSGKALGACRWVASLQRHS 487
                   *************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-144796IPR009057Homeodomain-like
SuperFamilySSF466896.68E-1547118IPR009057Homeodomain-like
PROSITE profilePS5007113.78357117IPR001356Homeobox domain
SMARTSM003891.2E-1359121IPR001356Homeobox domain
PfamPF000463.7E-1560116IPR001356Homeobox domain
CDDcd000862.90E-1360116No hitNo description
Gene3DG3DSA:1.10.10.602.7E-497142IPR009057Homeodomain-like
PROSITE profilePS5084820.119246492IPR002913START domain
CDDcd088754.96E-80252488No hitNo description
SuperFamilySSF559619.48E-16254487No hitNo description
SMARTSM002343.0E-11255489IPR002913START domain
PfamPF018525.1E-26270487IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MDTELELMAS YVSKLKFILQ EEQPELHTAT LLSSLGSSNQ DERYGHSAGE NRMETRIRKK  60
RKYQVLTAQQ RDRLNCAFQS CLHPDQNAIE ELANELNMSP DRVRYWFQNH KTQMKRFKNN  120
EERNLLQKEN EDLKEENAEL RNRMRNLTCH TCGLPLFHKD CCHLENAMLK GELKCKHGSA  180
STLIPQGVSS LLPSSSGLIA PGSNLGSNAV LVPESVMPSS VSQPAPALPN ANWPILHKLS  240
GNPNDGYGER DILFDLANRA VIEFITVMED EALWLPNMDI LAVESLNYQK YLAKSMTIGL  300
KPVNFKVDAT RDTAIVKGSC ADLVKGLSDV NWWRELFPGI VASANTTRII STGHSNSCDG  360
LLQLMHAELQ VMSPEIPVGD VTFLRQCVQN GTGLWYVVDV SINSVLGKSK SSQHSVQSTR  420
TTERHMEVRF LPSGCIIQEM GNGYSKVNWM VHAVYDERVI QELHWPLLRS GKALGACRWV  480
ASLQRHSQFF SSLCNSIPCP GSTVKEMLWR RNALHLVKQM TSSFTALCAS MSKAMLQDVD  540
VTQFANQIIG GATGEPVGQL LSATTTIWLP GVKPRHVYDY LHDEQCLVEW RYLFGDQLLQ  600
GNALPYGAPR NGEAVQKFYR MVNGLHEGHA ISLINPREID GSISSTLLLQ EARTDLSGSL  660
IVYAGIDVNT MHSIMTGDLD PATVFLVSSG CVILPDCLDS CPLLPPPTAD QASSSSSAGI  720
ASRSRTGGSF VTVAYQMFVS SQSSGGSSIN QGHDALKNAT NMFKASLETP ILA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695446.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
RefseqXP_006659280.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
RefseqXP_015695445.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
TrEMBLJ3MRW70.0J3MRW7_ORYBR; Uncharacterized protein
STRINGOB08G18460.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169781212
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.12e-98HD-ZIP family protein